Recombinant Human FGF-21 Protein
Product Sizes
10 ug
£127.00
RP00049-10UG
20 ug
£175.00
RP00049-20UG
50 ug
£240.00
RP00049-50UG
100 ug
£336.00
RP00049-100UG
About this Product
- SKU:
- RP00049
- Additional Names:
- FGF21, fibroblast growth factor 21
- Extra Details:
- Recombinant Human FGF-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (His29-Ser209) of human FGF-21 (Accession #NP_061986.1).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- His29-Ser209
- Molecular Weight:
- 19.41 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00049




