Recombinant Human FGF-21 Protein
Product Sizes
10 ug
£127.00
RP00049-10UG
20 ug
£175.00
RP00049-20UG
50 ug
£240.00
RP00049-50UG
100 ug
£336.00
RP00049-100UG
500 ug
£1002.00
RP00049-500UG
1000 ug
£1574.00
RP00049-1000UG
About this Product
- SKU:
- RP00049
- Additional Names:
- FGF21, fibroblast growth factor 21
- Extra Details:
- This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The protein stimulates the uptake of glucose in adipose tissue.
- Formulation:
- Recombinant Human FGF-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (His29-Ser209) of human FGF-21 (Accession #NP_061986.1).
- Immunogen:
- His29-Ser209
- Molecular Weight:
- 25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00049
