Recombinant Human Apolipoprotein A-I/APOA1 Protein
Product Sizes
10 ug
£145.00
RP00047-10UG
20 ug
£193.00
RP00047-20UG
50 ug
£288.00
RP00047-50UG
100 ug
£431.00
RP00047-100UG
500 ug
£1240.00
RP00047-500UG
1000 ug
£1954.00
RP00047-1000UG
About this Product
- SKU:
- RP00047
- Additional Names:
- apo(a),APOA1
- Extra Details:
- This protein is the major protein component of high density lipoprotein (HDL) in plasma. The preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters.
- Formulation:
- Recombinant Human Apolipoprotein A-I/APOA1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asp25-Gln267) of human Apolipoprotein A-I (Accession #NP_000
- Immunogen:
- Asp25-Gln267
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00047
