Recombinant Human Cystatin-A/CSTA Protein
Product Sizes
10 ug
£127.00
RP00043-10UG
20 ug
£175.00
RP00043-20UG
50 ug
£240.00
RP00043-50UG
100 ug
£336.00
RP00043-100UG
500 ug
£1002.00
RP00043-500UG
1000 ug
£1574.00
RP00043-1000UG
About this Product
- SKU:
- RP00043
- Additional Names:
- CSTA,AREI,PSS4,STF1,STFA
- Extra Details:
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer.
- Formulation:
- Recombinant Human Cystatin-A/CSTA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe98) of human Cystatin-A (Accession #NP_005204.1) fused with a
- Immunogen:
- Met1-Phe98
- Molecular Weight:
- 14 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00043
