Recombinant Human CNTF Protein
Product Sizes
10 ug
£145.00
RP00039-10UG
20 ug
£193.00
RP00039-20UG
50 ug
£288.00
RP00039-50UG
100 ug
£431.00
RP00039-100UG
About this Product
- SKU:
- RP00039
- Additional Names:
- CNTF,HCNTF
- Extra Details:
- Recombinant Human CNTF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met200) of human CNTF (Accession #NP_000605.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Met200
- Molecular Weight:
- 23.77 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00039
