Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein
Product Sizes
10 ug
£193.00
RP00037-10UG
20 ug
£258.00
RP00037-20UG
50 ug
£383.00
RP00037-50UG
100 ug
£586.00
RP00037-100UG
500 ug
£1716.00
RP00037-500UG
1000 ug
£2716.00
RP00037-1000UG
About this Product
- SKU:
- RP00037
- Additional Names:
- SULT1A1,HAST1/HAST2,P-PST,PST,ST1A1,ST1A3,STP,STP1,TSPST1
- Extra Details:
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.Particularly SULT1A1 (Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1), a member of the sulfotransferase 1 subfamily, which is a major pathway for drug metabolism in humans. Statistically significant associations were observed between the SULT1A1 genotype (Arg213His) and age, obesity and certain neoplasias (mammary, pulmonary, esophageal and urothelial cancer). Furthermore, the polymorphism of the SULT1A1 may be closely associated with breast cancer.
- Formulation:
- Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) f
- Immunogen:
- Met1-Leu295
- Molecular Weight:
- 32 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00037




