Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein
Product Sizes
10 ug
£193.00
RP00037-10UG
20 ug
£258.00
RP00037-20UG
50 ug
£383.00
RP00037-50UG
100 ug
£586.00
RP00037-100UG
About this Product
- SKU:
- RP00037
- Additional Names:
- SULT1A1,HAST1/HAST2,P-PST,PST,ST1A1,ST1A3,STP,STP1,TSPST1
- Extra Details:
- Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Leu295
- Molecular Weight:
- 35.01 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00037
