Recombinant Human Thioredoxin/SASP/TXN Protein
Product Sizes
10 ug
£107.00
RP00036-10UG
20 ug
£133.00
RP00036-20UG
100 ug
£240.00
RP00036-100UG
500 ug
£645.00
RP00036-500UG
1000 ug
£1002.00
RP00036-1000UG
About this Product
- SKU:
- RP00036
- Additional Names:
- TRDX, TRX, TRX1,TXN,TRX,TRX1
- Extra Details:
- Thioredoxin, also known as ATL-derived factor, Surface-associated sulphydryl protein, SASP and TXN, is a nucleus, cytoplasm and secreted protein which belongs to the thioredoxin family. Trx-1 is the only extracellular occurring thioredoxin, and is secreted by lymphocytes, hepatocytes, fibroblasts, and several tumor cells. Plasma concentrations of Trx-1 are up to 6 nM . In cells, Trx-1 is localized predominantly in the cytoplasm. Small amounts have been detected in the nucleus and in association with the outside surface of the cells. Biological functions of Trx-1 include growth factor activity, antioxidant properties, a cofactor that provides reducing equivalents, and transcriptional regulation.
- Formulation:
- Recombinant Human Thioredoxin/SASP/TXN Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Val105) of human Thioredoxin (Accession #NP_003320.2) fused
- Immunogen:
- Val2-Val105
- Molecular Weight:
- 15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00036
