Recombinant Human IL-36 gamma/IL-1F9 Protein
Product Sizes
10 ug
£163.00
RP00035-10UG
20 ug
£223.00
RP00035-20UG
50 ug
£336.00
RP00035-50UG
100 ug
£508.00
RP00035-100UG
About this Product
- SKU:
- RP00035
- Additional Names:
- IL36G,IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2
- Extra Details:
- Recombinant Human IL-36 gamma/IL-1F9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser18-Asp169) of human Interleukin-36 gamma (Accession #NP_062564.1 ).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Ser18-Asp169
- Molecular Weight:
- 17.03 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00035
