Recombinant Human IL-36Ra/IL-1F5 Protein
Product Sizes
10 ug
£145.00
RP00030-10UG
20 ug
£193.00
RP00030-20UG
50 ug
£288.00
RP00030-50UG
500 ug
£1240.00
RP00030-500UG
1000 ug
£1954.00
RP00030-1000UG
About this Product
- SKU:
- RP00030
- Additional Names:
- IL36RN,FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14
- Extra Details:
- Interleukin-1 family member 5 (IL-1F5), also known as interleukin 36 receptor antagonist (IL36RA), is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). IL-1F5 is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). IL-1F5 could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), which is present in epithelial barriers and takes part in local inflammatory response. It has been proved that IL-1F5 induces IL-4 mRNA and protein expression in glia in vitro and enhances hippocampal expression of IL-4 following intracerebroventricular injection. The inhibitory effect of IL-1F5 on LPS-induced IL-1B Beta is attenuated in cells from IL-4-defective mice.
- Formulation:
- Recombinant Human IL-36Ra/IL-1F5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Asp155) of human IL-36Ra (Accession #NP_036407.1) fused with a 6x
- Immunogen:
- Val2-Asp155
- Molecular Weight:
- 14-18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00030
