Recombinant Human IL-36Ra/IL-1F5 Protein
Product Sizes
10 ug
£145.00
RP00030-10UG
20 ug
£193.00
RP00030-20UG
50 ug
£288.00
RP00030-50UG
About this Product
- SKU:
- RP00030
- Additional Names:
- IL36RN,FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14
- Extra Details:
- Recombinant Human IL-36Ra/IL-1F5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Asp155) of human IL-36Ra (Accession #NP_036407.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Val2-Asp155
- Molecular Weight:
- 17.67 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00030
