Recombinant Human Leptin/LEP Protein
Product Sizes
50 ug
£127.00
RP00028-50UG
About this Product
- SKU:
- RP00028
- Additional Names:
- LEP,LEPD,OB,OBS,leptin
- Extra Details:
- Recombinant Human Leptin/LEP Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of human Leptin (Accession #NP_000221.1).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Val22-Cys167
- Molecular Weight:
- 16.03 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00028
