Recombinant Human IL-36 alpha/IL-1F6 Protein
Product Sizes
10 ug
£133.00
RP00027-10UG
20 ug
£181.00
RP00027-20UG
50 ug
£240.00
RP00027-50UG
100 ug
£353.00
RP00027-100UG
500 ug
£1002.00
RP00027-500UG
1000 ug
£1574.00
RP00027-1000UG
About this Product
- SKU:
- RP00027
- Additional Names:
- IL36A,FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6
- Extra Details:
- Interleukin-1 family member 6 (IL-1F6), also known as interleukin 36, alpha (IL36A), is a pro-inflammatory cytokine which plays an important role in innate and adaptive immunity.IL-1F6 can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this protein has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
- Formulation:
- Recombinant Human IL-36 alpha/IL-1F6 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe158) of human IL-36 alpha (Accession #NP_055255.1) fused w
- Immunogen:
- Met1-Phe158
- Molecular Weight:
- 14-18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00027




