Recombinant Human BID Protein
Product Sizes
10 ug
£133.00
RP00021-10UG
20 ug
£181.00
RP00021-20UG
50 ug
£240.00
RP00021-50UG
100 ug
£353.00
RP00021-100UG
500 ug
£1002.00
RP00021-500UG
1000 ug
£1574.00
RP00021-1000UG
About this Product
- SKU:
- RP00021
- Additional Names:
- BID,FP497
- Extra Details:
- The BH3 interacting domain death agonist (BID) is a pro-apoptotic member of the Bcl-2 protein family, which contains only the BH3 domain, and is required for its interaction with the Bcl-2 family proteins and for its pro-death activity. BID is important to cell death mediated by these proteases and thus is the sentinel to protease-mediated death signals. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release.
- Formulation:
- Recombinant Human BID Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Asp195) of human BID (Accession #NP_001187.1) fused with a 6xHis tag at the
- Immunogen:
- Met1-Asp195
- Molecular Weight:
- 18-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00021
