Recombinant Human IL-36 beta/IL-1F8 Protein
Product Sizes
10 ug
£163.00
RP00020-10UG
20 ug
£223.00
RP00020-20UG
50 ug
£336.00
RP00020-50UG
100 ug
£508.00
RP00020-100UG
About this Product
- SKU:
- RP00020
- Additional Names:
- FIL1,FIL1-(ETA),FIL1H,FILI-(ETA),IL-1F8,IL-1H2,IL1-ETA,IL1F8,IL1H2,IL36B
- Extra Details:
- Recombinant Human IL-36 beta/IL-1F8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg5-Glu157) of human IL-36 beta (Accession #NP_775270.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Arg5-Glu157
- Molecular Weight:
- 18.07 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00020




