Recombinant Human IL-33 Protein
Product Sizes
10 ug
£163.00
RP00019-10UG
50 ug
£336.00
RP00019-50UG
100 ug
£508.00
RP00019-100UG
500 ug
£1716.00
RP00019-500UG
1000 ug
£2716.00
RP00019-1000UG
About this Product
- SKU:
- RP00019
- Additional Names:
- IL33,C9orf26,DVS27,IL1F11,NF-HEV,NFEHEV
- Extra Details:
- Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial enules), is a proinflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells.
- Formulation:
- Recombinant Human IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser112-Thr270) of human IL-33 (Accession #NP_001300973.1).
- Immunogen:
- Ser112-Thr270
- Molecular Weight:
- 19 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00019
