Recombinant Human IL-33 Protein
Product Sizes
10 ug
£163.00
RP00019-10UG
50 ug
£336.00
RP00019-50UG
100 ug
£508.00
RP00019-100UG
About this Product
- SKU:
- RP00019
- Additional Names:
- IL33,C9orf26,DVS27,IL1F11,NF-HEV,NFEHEV
- Extra Details:
- Recombinant Human IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser112-Thr270) of human IL-33 (Accession #NP_001300973.1).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ser112-Thr270
- Molecular Weight:
- 17.99 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00019
