Recombinant Human VEGF-A/VEGF121(K321N) Protein
Product Sizes
10 ug
£145.00
RP00017-10UG
20 ug
£193.00
RP00017-20UG
50 ug
£288.00
RP00017-50UG
About this Product
- SKU:
- RP00017
- Additional Names:
- VEGFA, MVCD1, VEGF, VPF, vascular endothelial growth factor A,MVCD1,VEGF,VPF,L VEGFA,VEGF A
- Extra Details:
- Recombinant Human VEGF-A/VEGF121(K321N) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala207-Arg327 (Lys321Asn)) of human VEGF121 (Accession #NP_001020541.2).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM Tris, 100mM NaCl, pH 8.0.Contact us for customized product form or formulation.
- Immunogen:
- Ala207-Arg327(K321N)
- Molecular Weight:
- 14.06 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENCDKPRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00017
