Recombinant Human PPIase A/PPIA Protein
Product Sizes
10 ug
£107.00
RP00016-10UG
20 ug
£133.00
RP00016-20UG
50 ug
£163.00
RP00016-50UG
100 ug
£240.00
RP00016-100UG
500 ug
£645.00
RP00016-500UG
1000 ug
£1002.00
RP00016-1000UG
About this Product
- SKU:
- RP00016
- Additional Names:
- PPIA,CYPA,CYPH,HEL-S-69p
- Extra Details:
- This protein is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
- Formulation:
- Recombinant Human PPIase A/PPIA Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu165) of human PPIA (Accession #NP_066953.1).
- Immunogen:
- Met1-Glu165
- Molecular Weight:
- Approximately 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00016




