Recombinant Human UBE2D3 Protein
Product Sizes
10 ug
£107.00
RP00012-10UG
20 ug
£133.00
RP00012-20UG
50 ug
£163.00
RP00012-50UG
100 ug
£240.00
RP00012-100UG
About this Product
- SKU:
- RP00012
- Additional Names:
- UBE2D3,E2(17)KB3,UBC4/5,UBCH5C
- Extra Details:
- Recombinant Human UBE2D3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met147) of human UBE2D3 (Accession #NP_003331.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Met147
- Molecular Weight:
- 17.53 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP00012
