Recombinant Human IFN-alpha 1/13(Q114A) Protein
Product Sizes
10 ug
£133.00
RP00011-10UG
20 ug
£181.00
RP00011-20UG
50 ug
£240.00
RP00011-50UG
100 ug
£353.00
RP00011-100UG
About this Product
- SKU:
- RP00011
- Additional Names:
- IFNA1,IFL,IFN,IFN-ALPHA,IFN-alphaD,IFNA13,IFNA
- Extra Details:
- Recombinant Human IFN-alpha 1/13(Q114A) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu189 (Ala114)) of human IFNA1 (Accession #NP_076918.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Cys24-Glu189(Q114A)
- Molecular Weight:
- 21.01 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00011
