Recombinant Human IFN-alpha 1/13(Q114A) Protein
Product Sizes
10 ug
£133.00
RP00011-10UG
20 ug
£181.00
RP00011-20UG
50 ug
£240.00
RP00011-50UG
100 ug
£353.00
RP00011-100UG
500 ug
£1002.00
RP00011-500UG
1000 ug
£1574.00
RP00011-1000UG
About this Product
- SKU:
- RP00011
- Additional Names:
- IFNA1,IFL,IFN,IFN-ALPHA,IFN-alphaD,IFNA13,IFNA
- Extra Details:
- IFNA1, also known as IFN-alpha and IFNA, belongs to the alpha/beta interferon family. Interferons(IFNs) are proteins made and released by host cells in response to the presence of pathogens such as viruses, bacteria, parasites or tumor cells.Leukocyte interferon is produced predominantly by B lymphocytes. Immune interferon is produced by mitogen- or antigen-stimulated T lymphocytes. IFNA1 is produced by macrophages and has has both anti-viral and immunomodulatory activities on target cells.
- Formulation:
- Recombinant Human IFN-alpha 1/13(Q114A) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys24-Glu189 (Ala114)) of human IFNA1 (Accession #NP_076918.1)
- Immunogen:
- Cys24-Glu189(Q114A)
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00011






