Recombinant Human IL-1 beta Protein
Product Sizes
10 ug
£145.00
RP00002-10UG
20 ug
£193.00
RP00002-20UG
50 ug
£288.00
RP00002-50UG
100 ug
£431.00
RP00002-100UG
About this Product
- SKU:
- RP00002
- Additional Names:
- IL-1,IL1-BETA,IL1F2,IL1 beta,IL1B
- Extra Details:
- Recombinant Human IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of human IL-1 beta (Accession #NP_000567.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Ala117-Ser269
- Molecular Weight:
- 18.22 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00002










