Recombinant Human IL-1 beta Protein
Product Sizes
10 ug
£145.00
RP00002-10UG
20 ug
£193.00
RP00002-20UG
50 ug
£288.00
RP00002-50UG
100 ug
£431.00
RP00002-100UG
500 ug
£1240.00
RP00002-500UG
1000 ug
£1954.00
RP00002-1000UG
About this Product
- SKU:
- RP00002
- Additional Names:
- IL-1,IL1-BETA,IL1F2,IL1 beta,IL1B
- Extra Details:
- Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Formulation:
- Recombinant Human IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of human IL-1 beta (Accession #NP_000567.1) fused with an in
- Immunogen:
- Ala117-Ser269
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00002
