Phospho-p70 S6 Kinase 1-T421/S424 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
AP0502-5UL
20 ul
£163.00
AP0502-20UL
100 ul
£342.00
AP0502-100UL
500 ul
£1532.00
AP0502-500UL
1000 ul
£2704.00
AP0502-1000UL
About this Product
- SKU:
- AP0502
- Additional Names:
- p70 S6KA|p70-alpha|p70-S6K|p70(S6K)-alpha|Phospho-p70 S6 Kinase 1-T421/S424|PS6K|S6K|S6K-beta-1|S6K1|STK14A
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17.
- Formulation:
- Phospho T421/S424
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 70kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:AP0502
