Magnetic Beads-conjugated Rabbit anti GFP-Tag monoclonal antibody
Product Sizes
500 ul
£395.00
AE118-500UL
1000 ul
£544.00
AE118-1000UL
About this Product
- SKU:
- AE118
- Additional Names:
- GFP|GFP tag|GFP-tag
- Application:
- Immunoprecipitation
- Clonality:
- Monoclonal
- Conjugate:
- Magnetic Bead
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Label/Epitope-tag, Wide/Non-species Specific
- Sequence:
- MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKTRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Tagged Antibodies
- Manufacturer's Data Sheet:AE118
