FTSJ3 Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A9994-20UL
100 ul
£336.00
A9994-100UL
500 ul
£1258.00
A9994-500UL
1000 ul
£2228.00
A9994-1000UL
About this Product
- SKU:
- A9994
- Additional Names:
- EPCS3|FTSJ3|SPB1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 125kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- EGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A9994
