MT-ND4 Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A9941-20UL
100 ul
£336.00
A9941-100UL
500 ul
£1258.00
A9941-500UL
1000 ul
£2228.00
A9941-1000UL
About this Product
- SKU:
- A9941
- Additional Names:
- MT-ND4|ND4
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable NADH dehydrogenase (ubiquinone) activity and ubiquinone binding activity. Predicted to contribute to NADH dehydrogenase activity. Predicted to be involved in several processes, including electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Parkinson's disease; macular degeneration; and schizophrenia. Orthologous to human MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 51 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- LMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A9941
