POLE4 Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A9882-20UL
100 ul
£336.00
A9882-100UL
500 ul
£1258.00
A9882-500UL
1000 ul
£2228.00
A9882-1000UL
About this Product
- SKU:
- A9882
- Additional Names:
- p12|POLE4|YHHQ1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 17 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A9882
