GNGT2 Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A9818-20UL
100 ul
£336.00
A9818-100UL
500 ul
£1258.00
A9818-500UL
1000 ul
£2228.00
A9818-1000UL
About this Product
- SKU:
- A9818
- Additional Names:
- G-GAMMA-8|G-GAMMA-C|GNG9|GNGT2|GNGT8|HG3I
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 14kDa
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Sequence:
- MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A9818
