CDC25B Rabbit monoclonal antibody
Product Sizes
20 ul
£163.00
A9758-20UL
100 ul
£342.00
A9758-100UL
About this Product
- SKU:
- A9758
- Additional Names:
- CDC25B|cell division cycle 25B
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 65kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9758
