HIPK2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A9552-5UL
20 ul
£163.00
A9552-20UL
100 ul
£342.00
A9552-100UL
500 ul
£1532.00
A9552-500UL
1000 ul
£2704.00
A9552-1000UL
About this Product
- SKU:
- A9552
- Additional Names:
- hHIPk2|HIPK2|PRO0593
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can function as both a corepressor and a coactivator depending on the transcription factor and its subcellular localization. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 128kDa/140kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- STSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPPMIQNNASGATVATATTSTATSKNSGSNSEGDYQLVQHEVLCSMTNTYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9552
