CDC5L Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A9527-5UL
20 ul
£163.00
A9527-20UL
100 ul
£342.00
A9527-100UL
500 ul
£1532.00
A9527-500UL
1000 ul
£2704.00
A9527-1000UL
About this Product
- SKU:
- A9527
- Additional Names:
- CDC5|CDC5-LIKE|CDC5L|CEF1|dJ319D22.1|PCDC5RP
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 100kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- PQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9527
