Annexin A4/Annexin IV Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A9203-5UL
20 ul
£163.00
A9203-20UL
100 ul
£342.00
A9203-100UL
500 ul
£1532.00
A9203-500UL
1000 ul
£2704.00
A9203-1000UL
About this Product
- SKU:
- A9203
- Additional Names:
- Annexin A4/Annexin IV|ANX4|HEL-S-274|P32.5|PAP-II|PIG28|PP4-X|ZAP36
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 31kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9203
