NUP160 Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A9161-20UL
100 ul
£336.00
A9161-100UL
500 ul
£1258.00
A9161-500UL
1000 ul
£2228.00
A9161-1000UL
About this Product
- SKU:
- A9161
- Additional Names:
- NPHS19|NUP160
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- A structural constituent of nuclear pore. Involved in mRNA export from nucleus and nephron development. Part of nuclear pore outer ring. Colocalizes with kinetochore. Implicated in nephrotic syndrome type 19.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 160kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- ALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A9161
