p70 S6 Kinase 2 Rabbit monoclonal antibody
Product Sizes
20 ul
£163.00
A9100-20UL
100 ul
£342.00
A9100-100UL
About this Product
- SKU:
- A9100
- Additional Names:
- KLS|p70 S6 Kinase 2|P70-beta|P70-beta-1|P70-beta-2|p70(S6K)-beta|p70S6Kb|S6K-beta2|S6K2|S6KB|S6Kbeta|S6KI(2)|SRK|STK14B
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 53 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9100










