ASS1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A9084-5UL
20 ul
£163.00
A9084-20UL
100 ul
£342.00
A9084-100UL
500 ul
£1532.00
A9084-500UL
1000 ul
£2704.00
A9084-1000UL
About this Product
- SKU:
- A9084
- Additional Names:
- ASS|ASS1|CTLN1
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene catalyzes the penultimate step of the arginine biosynthetic pathway. There are approximately 10 to 14 copies of this gene including the pseudogenes scattered across the human genome, among which the one located on chromosome 9 appears to be the only functional gene for argininosuccinate synthetase. Mutations in the chromosome 9 copy of this gene cause citrullinemia. Two transcript variants encoding the same protein have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 47 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIAR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9084
