SKP1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A9021-5UL
20 ul
£163.00
A9021-20UL
100 ul
£342.00
A9021-100UL
500 ul
£1532.00
A9021-500UL
1000 ul
£2704.00
A9021-1000UL
About this Product
- SKU:
- A9021
- Additional Names:
- EMC19|OCP-II|OCP2|p19A|SKP1|SKP1A|TCEB1L
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a component of SCF complexes, which are composed of this protein, cullin 1, a ring-box protein, and one member of the F-box family of proteins. This protein binds directly to the F-box motif found in F-box proteins. SCF complexes are involved in the regulated ubiquitination of specific protein substrates, which targets them for degradation by the proteosome. Specific F-box proteins recognize different target protein(s), and many specific SCF substrates have been identified including regulators of cell cycle progression and development. Studies have also characterized the protein as an RNA polymerase II elongation factor. Alternative splicing of this gene results in two transcript variants. A related pseudogene has been identified on chromosome 7.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 19kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- HHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A9021
