Thioredoxin reductase 2 (TXNRD2 ) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A8884-5UL
20 ul
£163.00
A8884-20UL
100 ul
£342.00
A8884-100UL
500 ul
£1532.00
A8884-500UL
1000 ul
£2704.00
A8884-1000UL
About this Product
- SKU:
- A8884
- Additional Names:
- GCCD5|SELZ|Thioredoxin reductase 2 (TXNRD2 )|TR|TR-BETA|TR3|TRXR2
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes a mitochondrial form important for scavenging reactive oxygen species in mitochondria. It functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternatively spliced transcript variants encoding different isoforms, including a few localized in the cytosol and some lacking the C-terminal Sec residue, have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 57kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A8884
