Arp2 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A8876-5UL
20 ul
£163.00
A8876-20UL
100 ul
£342.00
A8876-100UL
500 ul
£1532.00
A8876-500UL
1000 ul
£2704.00
A8876-1000UL
About this Product
- SKU:
- A8876
- Additional Names:
- ARP2
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Two transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 45kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- SEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A8876
