HDAC8 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A8865-5UL
20 ul
£163.00
A8865-20UL
100 ul
£342.00
A8865-100UL
500 ul
£1532.00
A8865-500UL
1000 ul
£2704.00
A8865-1000UL
About this Product
- SKU:
- A8865
- Additional Names:
- C8|CDA07|CDLS5|HD8|HDACL1|KDAC8|MRXS6|RPD3|WTS
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation
- Clonality:
- Monoclonal
- Extra Details:
- Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase family. It catalyzes the deacetylation of lysine residues in the histone N-terminal tails and represses transcription in large multiprotein complexes with transcriptional co-repressors. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A8865
