Complement factor H Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A8798-5UL
20 ul
£163.00
A8798-20UL
100 ul
£342.00
A8798-100UL
500 ul
£1532.00
A8798-500UL
1000 ul
£2704.00
A8798-1000UL
About this Product
- SKU:
- A8798
- Additional Names:
- AHUS1|AMBP1|ARMD4|ARMS1|CFHL3|Complement factor H|FH|FHL1|HF|HF1|HF2|HUS
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene is a member of the Regulator of Complement Activation (RCA) gene cluster and encodes a protein with twenty short consensus repeat (SCR) domains. This protein is secreted into the bloodstream and has an essential role in the regulation of complement activation, restricting this innate defense mechanism to microbial infections. Mutations in this gene have been associated with hemolytic-uremic syndrome (HUS) and chronic hypocomplementemic nephropathy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 139kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- GGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A8798
