[KO Validated] B4GALT1 Rabbit polyclonal antibody
Product Sizes
20 ul
£169.00
A8546-20UL
100 ul
£401.00
A8546-100UL
About this Product
- SKU:
- A8546
- Additional Names:
- B4GAL-T1|beta4Gal-T1|CDG2D|GGTB2|GT1|GTB|T1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 44kda
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- RDLSRLPQLVGVSTPLQGGSNSAAAIGQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGPMLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A8546
