Aggrecan Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A8536-20UL
100 ul
£336.00
A8536-100UL
500 ul
£1258.00
A8536-500UL
1000 ul
£2228.00
A8536-1000UL
About this Product
- SKU:
- A8536
- Additional Names:
- AGC1|AGCAN|Aggrecan|CSPG1|CSPGCP|MSK16|SEDK|SSOAOD
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene is a member of the aggrecan/versican proteoglycan family. The encoded protein is an integral part of the extracellular matrix in cartilagenous tissue and it withstands compression in cartilage. Mutations in this gene may be involved in skeletal dysplasia and spinal degeneration. Multiple alternatively spliced transcript variants that encode different protein isoforms have been observed in this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- Refer to figures
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- FAPEIGATAFAEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVFHYRPGPTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVSPRTPCVGDKDSSPGVRTYGVRPSTETYDVYCFVDR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A8536
