MYL1 Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A8438-20UL
100 ul
£336.00
A8438-100UL
500 ul
£1258.00
A8438-500UL
1000 ul
£2228.00
A8438-1000UL
About this Product
- SKU:
- A8438
- Additional Names:
- CMYP14|MLC-1|MLC1|MLC1/3|MLC1F|MLC3F|MYL1|MYOFTA
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in fast skeletal muscle. Two transcript variants have been identified for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 27kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVLRALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFLPMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALMAGQEDSNGCINYEAFVKHIMSI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A8438
