ESRRB Rabbit polyclonal antibody
Product Sizes
20 ul
£151.00
A8416-20UL
100 ul
£336.00
A8416-100UL
500 ul
£1258.00
A8416-500UL
1000 ul
£2228.00
A8416-1000UL
About this Product
- SKU:
- A8416
- Additional Names:
- DFNB35|ERR beta-2|ERR2|ERRb|ERRbeta2|ESRL2|ESRRB|NR3B2
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 56kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- GQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSNSPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A8416
