IFI44 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A8188-20UL
100 ul
£336.00
A8188-100UL
500 ul
£1258.00
A8188-500UL
1000 ul
£2228.00
A8188-1000UL
About this Product
- SKU:
- A8188
- Additional Names:
- A430056A10Rik|IFI44|MTAP44|p44
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Acts upstream of or within response to bacterium. Predicted to be located in cytoplasm. Is expressed in central nervous system and retina. Orthologous to human IFI44 (interferon induced protein 44).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 50kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- LFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVFQGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQFNPMESIKLNHHDYIDSPS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A8188
