Gm13125 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A8095-20UL
100 ul
£336.00
A8095-100UL
500 ul
£1258.00
A8095-500UL
1000 ul
£2228.00
A8095-1000UL
About this Product
- SKU:
- A8095
- Additional Names:
- EG627009|Gm13125|Pramef20
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Predicted to enable ubiquitin ligase-substrate adaptor activity. Predicted to be part of Cul2-RING ubiquitin ligase complex. Predicted to be active in cytoplasm. Orthologous to several human genes including PRAMEF1 (PRAME family member 1); PRAMEF10 (PRAME family member 10); and PRAMEF11 (PRAME family member 11).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- GALKKRTPYLETQLQVVLEEVDKLLIQEVHPREYKLEVLDLRSVGQNYLNVWPGAMDDWLPKTTQTDPCCSKTVMTQPLKVLVDLQLNNRGQSRLFSYLVQWSDRRKGLLQLYCNKLQIWSPSQQNYRKLSQKVNLDYVETLGLHSSCSPSFLLNFAPYLRQMRNLRKLALSNIREEHIISPEKRRCIITRFTLQILKLESLQKLHLD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A8095
