CFHR3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A7775-20UL
100 ul
£336.00
A7775-100UL
500 ul
£1258.00
A7775-500UL
1000 ul
£2228.00
A7775-1000UL
About this Product
- SKU:
- A7775
- Additional Names:
- CFHL3|CFHR3|DOWN16|FHR-3|FHR3|HLF4
- Application:
- ELISA, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene is a secreted protein, which belongs to the complement factor H-related protein family. It binds to heparin, and may be involved in complement regulation. Mutations in this gene are associated with decreased risk of age-related macular degeneration, and with an increased risk of atypical hemolytic-uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 37kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- AVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGLPKAQTTVTCTEKGWSPTPRCIRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYATADGNSSGSITCLQNGWSAQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A7775
