CD7 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A7650-20UL
100 ul
£336.00
A7650-100UL
500 ul
£1258.00
A7650-500UL
1000 ul
£2228.00
A7650-1000UL
About this Product
- SKU:
- A7650
- Additional Names:
- CD7|GP40|LEU-9|Tp40|TP41
- Application:
- ELISA, Flow Cytometry, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 38-40kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Rat
- Sequence:
- AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A7650
