CCL3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A7568-20UL
100 ul
£336.00
A7568-100UL
500 ul
£1258.00
A7568-500UL
1000 ul
£2228.00
A7568-1000UL
About this Product
- SKU:
- A7568
- Additional Names:
- CCL3|G0S19-1|LD78ALPHA|MIP-1-alpha|MIP1A|SCYA3
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 11kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A7568
