SIRT6 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A7416-20UL
100 ul
£336.00
A7416-100UL
500 ul
£1258.00
A7416-500UL
1000 ul
£2228.00
A7416-1000UL
About this Product
- SKU:
- A7416
- Additional Names:
- 2810449N18Rik|mSIRT6|Sir2l6|SIRT6
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables several functions, including NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD-dependent histone deacetylase activity (H3-K9 specific); and transcription corepressor activity. Involved in several processes, including cellular protein modification process; negative regulation of nucleobase-containing compound metabolic process; and positive regulation of cell population proliferation. Located in nucleus. Is expressed in several structures, including alimentary system; central nervous system; gonad; musculature; and retina. Used to study progeria. Orthologous to human SIRT6 (sirtuin 6).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 36-42 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- NLQPTKHDRQADLRIHGYVDEVMCRLMKHLGLEIPAWDGPCVLDKALPPLPRPVALKAEPPVHLNGAVHVSYKSKPNSPILHRPPKRVKTEAAPS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A7416
