Bcl9 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A6795-20UL
100 ul
£336.00
A6795-100UL
500 ul
£1258.00
A6795-500UL
1000 ul
£2228.00
A6795-1000UL
About this Product
- SKU:
- A6795
- Additional Names:
- 2610202E01Rik|8030475K17Rik|A330041G23Rik|Bcl9|Gm130
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Enables beta-catenin binding activity. Acts upstream of or within several processes, including myotube differentiation involved in skeletal muscle regeneration; skeletal muscle cell differentiation; and somatic stem cell population maintenance. Located in cis-Golgi network and nucleus. Is expressed in several structures, including brain; eye; head surface ectoderm; metanephros; and thymus primordium. Orthologous to human BCL9 (BCL9 transcription coactivator).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 160kDa/170kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- DQAPRMGLALPGMGGPGPVGTPDIPLGTSPSMPGHNPMRPPAFLQQGMMGPHHRMMSPAQSTVPGPATLMTNPAAAVGMIPGKDRGPAGLYTHPGPVGSP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A6795
