MATK Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A6651-20UL
100 ul
£336.00
A6651-100UL
500 ul
£1258.00
A6651-500UL
1000 ul
£2228.00
A6651-1000UL
About this Product
- SKU:
- A6651
- Additional Names:
- CHK|CTK|HHYLTK|HYL|HYLTK|Lsk|MATK
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The protein encoded by this gene has amino acid sequence similarity to Csk tyrosine kinase and has the structural features of the CSK subfamily: SRC homology SH2 and SH3 domains, a catalytic domain, a unique N terminus, lack of myristylation signals, lack of a negative regulatory phosphorylation site, and lack of an autophosphorylation site. This protein is thought to play a significant role in the signal transduction of hematopoietic cells. It is able to phosphorylate and inactivate Src family kinases, and may play an inhibitory role in the control of T-cell proliferation. This protein might be involved in signaling in some cases of breast cancer. Three alternatively spliced transcript variants that encode different isoforms have been described for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 56kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- PEALKHGKFTSKSDVWSFGVLLWEVFSYGRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPASVSGQDADGSTSPRSQEP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A6651
