SERPINB9 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A6393-20UL
100 ul
£336.00
A6393-100UL
500 ul
£1258.00
A6393-500UL
1000 ul
£2228.00
A6393-1000UL
About this Product
- SKU:
- A6393
- Additional Names:
- CAP-3|CAP3|PI-9|PI9|SERPINB9
- Application:
- ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- KWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A6393
