KCNJ5 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A6232-20UL
100 ul
£336.00
A6232-100UL
500 ul
£1258.00
A6232-500UL
1000 ul
£2228.00
A6232-1000UL
About this Product
- SKU:
- A6232
- Additional Names:
- CIR|GIRK4|KATP1|KCNJ5|KIR3.4|LQT13
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes an integral membrane protein which belongs to one of seven subfamilies of inward-rectifier potassium channel proteins called potassium channel subfamily J. The encoded protein is a subunit of the potassium channel which is homotetrameric. It is controlled by G-proteins and has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Naturally occurring mutations in this gene are associated with aldosterone-producing adenomas.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 47kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- RQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A6232
